PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 105aa    MW: 12700 Da    PI: 8.8173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06950genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM484e-1545105162
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFs 62 
               lppGf FhPt+ e++ +yL +kv++k +++ ++++e d+ k++ w+Lp++v+ +eke yfFs
  EMT06950  45 LPPGFGFHPTNMEIIIFYLVPKVQKKAFDT-TMVREEDMKKYDLWNLPNEVNMGEKERYFFS 105
               79**************************99.88***************99999********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-1641105IPR003441NAC domain
PROSITE profilePS5100518.37245105IPR003441NAC domain
PfamPF023651.8E-546105IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MEIIIFYLVP KVLKKAFDTT MVREVDMKKY ELWNLPNEKK QQLNLPPGFG FHPTNMEIII  60
FYLVPKVQKK AFDTTMVREE DMKKYDLWNL PNEVNMGEKE RYFFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D6e-14421051780NAC domain-containing protein 19
3swp_C6e-14421051780NAC domain-containing protein 19
3swp_B6e-14421051780NAC domain-containing protein 19
3swp_A6e-14421051780NAC domain-containing protein 19
3swm_D6e-14421051780NAC domain-containing protein 19
3swm_C6e-14421051780NAC domain-containing protein 19
3swm_B6e-14421051780NAC domain-containing protein 19
3swm_A6e-14421051780NAC domain-containing protein 19
4dul_B7e-14421051477NAC domain-containing protein 19
4dul_A7e-14421051477NAC domain-containing protein 19
1ut7_B7e-14421051477NO APICAL MERISTEM PROTEIN
1ut7_A7e-14421051477NO APICAL MERISTEM PROTEIN
1ut4_B7e-14421051477NO APICAL MERISTEM PROTEIN
1ut4_A7e-14421051477NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3757623e-56AK375762.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3103J16.
GenBankFR8197613e-56FR819761.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC009 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016198189.17e-20PREDICTED: NAC domain-containing protein 92-like
TrEMBLM8AZ173e-72M8AZ17_AEGTA; NAC domain-containing protein 77
STRINGMLOC_57427.11e-28(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.14e-17NAC domain containing protein 6